PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_25377_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB_related
Protein Properties Length: 304aa    MW: 34341.4 Da    PI: 9.6336
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_25377_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.4e-15136180347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + + Rt+ q+ s+ qky
   Neem_25377_f_3 136 PWTEEEHKLFLLGLKKHGKGDWRNISRNFVTSRTPTQVASHAQKY 180
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-42373IPR009057Homeodomain-like
PROSITE profilePS512937.6232477IPR017884SANT domain
SMARTSM007172.8E-92577IPR001005SANT/Myb domain
SuperFamilySSF466892.39E-112782IPR009057Homeodomain-like
CDDcd001672.03E-72874No hitNo description
Gene3DG3DSA:1.10.10.602.9E-12128185IPR009057Homeodomain-like
PROSITE profilePS5129419.758129185IPR017930Myb domain
SuperFamilySSF466894.45E-17130184IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-16132184IPR006447Myb domain, plants
SMARTSM007175.7E-13133183IPR001005SANT/Myb domain
PfamPF002492.1E-12136180IPR001005SANT/Myb domain
CDDcd001674.99E-11136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MKWETEVISP SSCLSSSSWL LEESKSTKWT AAENKMFENA LAVYDKESPD RWHKVAAMIP  60
GKTVMDVIKQ YKELEDDISN IEAGLIPIPG YSNSSPFTLE WVSNHSYGGY KQSYGIGGKR  120
SSSVRHAEQE RKKGVPWTEE EHKLFLLGLK KHGKGDWRNI SRNFVTSRTP TQVASHAQKY  180
FIRQLSGGKD KRRASIHDIT TVNLNETRTP SPDNQRTPSP NHSTVLSQQP NSGVLPRTDF  240
QWNQPNNGTT MGFNSTQGNM LMTSPYGINS YGLKMQGQNL QRDAVHEPYF GLQNLAFHMQ  300
YPQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1529941176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00568DAPTransfer from AT5G58900Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006425017.10.0hypothetical protein CICLE_v10028910mg
RefseqXP_006488482.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-146DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A067FUC60.0A0A067FUC6_CITSI; Uncharacterized protein
TrEMBLV4SCK80.0V4SCK8_9R
STRINGPOPTR_0009s04730.11e-175(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-86Homeodomain-like transcriptional regulator